SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008001 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008001
Domain Number 1 Region: 156-243
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000389
Family RING finger domain, C3HC4 0.037
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008001
Domain Number - Region: 55-112
Classification Level Classification E-value
Superfamily Gam-like 0.0759
Family Gam-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008001   Gene: ENSGGOG00000008184   Transcript: ENSGGOT00000008221
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:8:124827493:125104326:1 gene:ENSGGOG00000008184 transcript:ENSGGOT00000008221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYS
MDKAMVEFATLDRQLNHYVKAVQSTINHVKEEHPEKIPDLKLLVEKKFLALQSKNSDADF
QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV
KNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNK
KRHRHSE
Download sequence
Identical sequences G3QYQ9
ENSGGOP00000008001 XP_004047567.1.27298 XP_004047568.1.27298 ENSGGOP00000008001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]