SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008045 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008045
Domain Number 1 Region: 64-256
Classification Level Classification E-value
Superfamily Sec7 domain 9.03e-77
Family Sec7 domain 0.0000000466
Further Details:      
 
Domain Number 2 Region: 264-385
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008045   Gene: ENSGGOG00000008228   Transcript: ENSGGOT00000008266
Sequence length 399
Comment pep:known_by_projection chromosome:gorGor3.1:22:21608763:21632307:1 gene:ENSGGOG00000008228 transcript:ENSGGOT00000008266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREGGPAEVRAKPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEE
SRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDIQDIARFLYKGEGLNKTAIGTYL
GERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCN
PGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLF
DSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTT
DKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRI
SATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
Download sequence
Identical sequences ENSGGOP00000008045 ENSGGOP00000027487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]