SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008056
Domain Number 1 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-25
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 3 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 123-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 222-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000483
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008056   Gene: ENSGGOG00000008242   Transcript: ENSGGOT00000008279
Sequence length 466
Comment pep:known_by_projection chromosome:gorGor3.1:19:49243988:49289703:-1 gene:ENSGGOG00000008242 transcript:ENSGGOT00000008279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFRDVAVGFTWEEWQLLDPVQKNLYQDVMLENYSNLVSLGYQGTKPDSLFKLEQGE
PPGIVEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKHDKTLTGVKYHRCVKPS
SPKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTERGEKPHGCGECGKTFMRKI
QLTEHQRTHTGEKPHECSECGKAFSRKSQLMVHQRTHTGEKPYRCSECGKAFSRKCRLNR
HQRSHTGEKLYGCSVCGKAFSQKAYLTAHQRLHTGDKPYKCSDCGRTFYFKSDLTRHQRI
HTGEKPYECSECEKAFRSKSKLIQHQRTHTGERPYSCSECGKAFAHMSVLIKHKKTHIRE
TAINSLKVEKPSSRSHTSLYVSELIQEQKTVNTVPIEMPSSGTPPLLNKSERLVGRNVVI
VEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSVINYILYLADIVSE
Download sequence
Identical sequences ENSGGOP00000008056 ENSGGOP00000008056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]