SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000008158

Domain assignment for ENSGGOP00000008158 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

No Significant Hits.

Weak hits

Sequence:	ENSGGOP00000008158
Domain Number -	Region: 178-202
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0034
Family	CCCH zinc finger	0.0032
Further Details:

Domain Number -	Region: 13-41
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0089
Family	CCCH zinc finger	0.0036
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000008158 Gene: ENSGGOG00000008349 Transcript: ENSGGOT00000008385
Sequence length	373
Comment	pep:known_by_projection chromosome:gorGor3.1:13:80238976:80417102:1 gene:ENSGGOG00000008349 transcript:ENSGGOT00000008385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP AIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLE VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHL QAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPKRQALEKSNGTSAVFNPSVLH YQQALTSAQLQQHAAFIPTGSVLCMTPATSIDNSEIISRNGMECQESALRITKHCYCTYY PVSSSIELPQTAC
Download sequence
Identical sequences	A0A2I2Z8Y8 A0A2I3FUH2 A0A2I3LGJ2 A0A2J8M935 A0A2J8X8L4 A0A2K5EME0 A0A2K5ILS7 A0A2K5NC69 A0A2K5S867 A0A2K5YAM8 A0A2K6E7E7 F6UL98 G7NJI6 G7PVM0 Q5R4F5 Q5VZF2 ENSGGOP00000008158 ENSCJAP00000007802 9598.ENSPTRP00000056966 ENSPTRP00000056966 ENSP00000365861 NP_001292999.1.87134 NP_001292999.1.92137 XP_001141054.1.37143 XP_003832083.1.60992 XP_003928258.1.74449 XP_004088205.1.23891 XP_007958907.1.81039 XP_011732461.1.29376 XP_011789196.1.43180 XP_011826051.1.47321 XP_011890842.1.92194 XP_012314053.1.9421 XP_016875798.1.92137 XP_017385540.1.71028 XP_017825542.1.60252 ENSPTRP00000056966 ENSP00000365861 ENSGGOP00000008158 ENSP00000404202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]