SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008342 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008342
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 262-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000848
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 189-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000214
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008342   Gene: ENSGGOG00000008538   Transcript: ENSGGOT00000008572
Sequence length 583
Comment pep:known_by_projection chromosome:gorGor3.1:19:49408698:49418606:-1 gene:ENSGGOG00000008538 transcript:ENSGGOT00000008572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKL
EHGQEPWITDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTH
FPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGGEKTLLHGKHERTHTKTRFS
ENAKCIHTKFQVFKHQRTQKIEKPHACIECEQTFLRKSQLIYHENICIQENPGSGQCEKL
SRSVLFTKHLKTNTTDKICIPSEYRKGSTVKTSLITHQQTHTEEKSYMCSECGKGFTMKR
YLIAHQRTHSGEKPYVCNECGKGFTVKSNLIVHQRTHTGEKPYICSECGKGFTMKRYLVV
HQRTHTGEKPYMCSECGKGFTVKSNLIVHQRSHTGEKSYICSECGKGFTVKRTLIIHQRT
HTGEKSYICNECGKGFTTKRTLIIHQRTHTGEKPYECNECGKAFSQKICLIQHERCHTGK
TPFVCTDCGKSYSHKYGLITHQRIHTGEKPYECNECGKAFTTKSVLNVHQRTHTGERPYG
CSDCEKAFSHLSNLVKHKKMHTRGRISQVENSCNGESQLLPYK
Download sequence
Identical sequences ENSGGOP00000008342 ENSGGOP00000008342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]