SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008349 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008349
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 1.26e-44
Family Calmodulin-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008349   Gene: ENSGGOG00000008541   Transcript: ENSGGOT00000008579
Sequence length 200
Comment pep:known_by_projection chromosome:gorGor3.1:17:10180375:10189368:-1 gene:ENSGGOG00000008541 transcript:ENSGGOT00000008579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
Download sequence
Identical sequences G3QZN4 H2NSQ6 H2QC95 P35243
ENSGGOP00000008349 NP_002894.1.87134 NP_002894.1.92137 XP_002827073.1.23681 XP_003818145.1.60992 XP_004058625.1.27298 XP_009431030.1.37143 ENSPPYP00000008969 gi|4506459|ref|NP_002894.1| ENSGGOP00000008349 ENSP00000226193 ENSPTRP00000014928 hsi002004436.1 ENSPTRP00000014928 ENSP00000226193 9598.ENSPTRP00000014928 9600.ENSPPYP00000008969 9606.ENSP00000226193 ENSPPYP00000008969 ENSP00000226193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]