SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008358 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000008358
Domain Number - Region: 79-143
Classification Level Classification E-value
Superfamily EF-hand 0.0316
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008358   Gene: ENSGGOG00000008547   Transcript: ENSGGOT00000008588
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:11:47701772:47925728:1 gene:ENSGGOG00000008547 transcript:ENSGGOT00000008588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHI
LFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKA
ARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSG
QHRQRPALGEAGMLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLM
ALSKHHGINQALGALPDKGDLMHDPAMDEELERLLLLFFRLAQVPGLVNSVTASPEASCL
PSRTPPRVGSPWRPLHHHSRKVDGESDGSTEETDESET
Download sequence
Identical sequences ENSGGOP00000008358 ENSGGOP00000008358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]