SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008384 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008384
Domain Number 1 Region: 237-330
Classification Level Classification E-value
Superfamily Immunoglobulin 5.82e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 342-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000432
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008384   Gene: ENSGGOG00000008570   Transcript: ENSGGOT00000008615
Sequence length 733
Comment pep:known_by_projection chromosome:gorGor3.1:5:123207335:123603202:-1 gene:ENSGGOG00000008570 transcript:ENSGGOT00000008615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSSESGSSSRSSSNNSSISRP
AAPPEPRPQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKS
VQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQV
ISVGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKL
KKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFN
KVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVC
YYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITG
ICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMA
DYISKNVPATDHVIRRQTETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTS
DSQSGIMLSSVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSER
YVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHP
APPGPGPGPGPGXXXXXXVPGTCSAESQPAAGPGPRQSPPAVPGSGARVAPPRLARGGEG
GEPAAPAPPPPPR
Download sequence
Identical sequences ENSGGOP00000008384 ENSGGOP00000008384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]