SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008439 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008439
Domain Number 1 Region: 156-276
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.02e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008439   Gene: ENSGGOG00000008633   Transcript: ENSGGOT00000008671
Sequence length 443
Comment pep:known_by_projection chromosome:gorGor3.1:1:33099131:33130106:1 gene:ENSGGOG00000008633 transcript:ENSGGOT00000008671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPA
TQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPP
PAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY
Download sequence
Identical sequences A0A2J8Y7F3 A0A2K5DB53 A0A2K5P2C6 A0A2K5U823 A0A2K6CKD2 A0A2K6KCI7 G3QZW8 H2PYJ6 H9EMX6 Q07666 U3DMI6
ENSPTRP00000000822 ENSP00000313829 HR5545 gi|5730027|ref|NP_006550.1| ENSGGOP00000008439 ENSP00000313829 NP_006550.1.87134 NP_006550.1.92137 XP_002750593.1.60252 XP_002811176.1.23681 XP_003828185.1.60992 XP_004025401.1.27298 XP_010352171.1.97406 XP_011761511.1.29376 XP_012295381.1.9421 XP_014989375.1.72884 XP_015306650.1.63531 XP_513273.3.37143 ENSP00000313829 ENSGGOP00000008439 ENSPTRP00000000822 9598.ENSPTRP00000000822 9600.ENSPPYP00000001850 9606.ENSP00000313829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]