SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008487 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008487
Domain Number 1 Region: 141-249
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 247-350
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 27-144
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008487   Gene: ENSGGOG00000008678   Transcript: ENSGGOT00000008720
Sequence length 654
Comment pep:known_by_projection chromosome:gorGor3.1:11:57745012:57758828:1 gene:ENSGGOG00000008678 transcript:ENSGGOT00000008720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGHPSPAPSDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALW
DSRAAEAVCRALGCGGAEAASQLALPTPELPPPPAAGNTSAAANATLAGAPALLCSGAEW
RLCEVVEHACRSDGRRARVTCAENRALRLVDGGSSCAGRVEMLEHGEWGSVCDDTWDLED
AHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKED
AGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVER
PKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEV
PANVQTVTIESSVTVKIENKESRELMLLIPSIVLGILFLGSLIFIAFILLRIKGKYALPV
MVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQ
PPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPAANPGHCITDPPSLGP
QYHPRSNSESSTSSGEDYCNSPKSKPPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAG
PPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDIGAA
Download sequence
Identical sequences ENSGGOP00000008487 ENSGGOP00000008487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]