SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008512 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008512
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-19
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 3 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000131
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000028
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 139-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000225
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008512   Gene: ENSGGOG00000008705   Transcript: ENSGGOT00000008745
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:19:11981349:11996688:1 gene:ENSGGOG00000008705 transcript:ENSGGOT00000008745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAINFTCEEWALLGPSQKSLYRDVMQETIRNLDCIGMIWQNQDIEEDEYKDL
RRNLRCHMVERSCEIKDDSQCGGPFTQIQDSIVNEKIPGVDPWESSECTEVLMGRSSLNC
YISVDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGKKLYDCKECASFSSL
ENLQRHMAAHHGDGPRICKLCGNAFIWPSLFHMLRRTHTEEKPYEYEQCSTAFPAYSSTL
RHERTHSGEKPYQCKQCGKAFSCSCYTQLYERTHTGEQSYECKQCGKAFTCSTSFQYHER
THTGEKPYECKECGKAFSHSSYLRIHERVHTGEKPYKCKECGKPFHCPSAFHKHERTHSM
EKPYKCKECGEAFHCISSFHEHEVTH
Download sequence
Identical sequences ENSGGOP00000008512 ENSGGOP00000008512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]