SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008535 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008535
Domain Number 1 Region: 238-347
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00041
Further Details:      
 
Domain Number 2 Region: 137-241
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 
Domain Number 3 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008535   Gene: ENSGGOG00000008730   Transcript: ENSGGOT00000008769
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:1:136823104:136833307:-1 gene:ENSGGOG00000008730 transcript:ENSGGOT00000008769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFSLILAIYTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
VCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLG
CGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
PFDLRLVGGDNLCCGRLEVLHKGVWGSVCDDDWGEKEDQVVCKQLGCGKSLSPSFRNRKS
YGPGVGRIWLDNVRCSGEEQSLEQCKHRFWGFHDCTHQEDVAVFCSG
Download sequence
Identical sequences G3R058
ENSGGOP00000008535 ENSGGOP00000008535 XP_018880526.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]