SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008552 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008552
Domain Number 1 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 83-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 304-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000135
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 352-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000199
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008552   Gene: ENSGGOG00000008748   Transcript: ENSGGOT00000008787
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:19:2918067:2929122:1 gene:ENSGGOG00000008748 transcript:ENSGGOT00000008787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTVVFEDVVVDFTLEEWPLLNPAQRKLYRDVMLETFKHLASVRNPRVERPCKSSKDNKR
GRTFRKTRNCNRHLRKNHCTSVRWYECSQCGKLFTHSSSLMRHKRAHSGQKLYKCKECGK
AFSCPSYLQTHEKTHSGEKPYACQSCGKTFLRSHSLTEHVRTHTGEKPYECGQCGKGFSC
PKSFRVHVMMHAGGRPYECKHCGKAFRCQKSFRVHMIMHAGGRPYECKQCGKAYCWATSF
QRHVRIHNGEKPYKCEKCGKAFGWPSSLHKHARTHAKKKPVSGGRVGKSSARPRPSTDVK
SQTREVYKCETCGKTYGWSSSLHKHERKHTGEKPVNAASVGKPSGGLCSSKNVRTQIGQK
PNKCEKCGKAFSCPKAFQGHVRSHTGKKPCTST
Download sequence
Identical sequences ENSGGOP00000008552 ENSGGOP00000008552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]