SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008679 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008679
Domain Number 1 Region: 11-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.54e-19
Family Canonical RBD 0.00066
Further Details:      
 
Domain Number 2 Region: 397-480
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 277-356
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 193-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 485-563
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000134
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008679   Gene: ENSGGOG00000008872   Transcript: ENSGGOT00000008916
Sequence length 578
Comment pep:known_by_projection chromosome:gorGor3.1:5:35014414:35078904:-1 gene:ENSGGOG00000008872 transcript:ENSGGOT00000008916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNRVGVSNPAPQNXTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSG
KVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESET
AVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQ
GSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGA
AEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNL
KKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMS
LQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGA
IIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENF
FGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKI
IGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Download sequence
Identical sequences ENSGGOP00000008679 ENSGGOP00000008679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]