SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008730 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008730
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-17
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 2 Region: 178-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000033
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 136-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008730   Gene: ENSGGOG00000008932   Transcript: ENSGGOT00000008968
Sequence length 224
Comment pep:novel chromosome:gorGor3.1:7:61865414:61883152:1 gene:ENSGGOG00000008932 transcript:ENSGGOT00000008968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLTFMDMAIEFSLEECQCLDTAQRNVYRHVMLENYRNVVFLDLITCLEQGKEPWNMKRH
EMVVAKHSGLCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDEYKGHQ
GGYNGLNQCLKITSSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECGKSLCMLSC
LTQHKRIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKC
Download sequence
Identical sequences ENSGGOP00000008730 ENSGGOP00000008730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]