SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008874 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008874
Domain Number 1 Region: 23-212
Classification Level Classification E-value
Superfamily Cupredoxins 1.68e-55
Family Multidomain cupredoxins 0.00000553
Further Details:      
 
Domain Number 2 Region: 222-366
Classification Level Classification E-value
Superfamily Cupredoxins 7.98e-50
Family Multidomain cupredoxins 0.00000442
Further Details:      
 
Domain Number 3 Region: 731-910
Classification Level Classification E-value
Superfamily Cupredoxins 5.36e-48
Family Multidomain cupredoxins 0.00000334
Further Details:      
 
Domain Number 4 Region: 377-571
Classification Level Classification E-value
Superfamily Cupredoxins 1.96e-47
Family Multidomain cupredoxins 0.00000588
Further Details:      
 
Domain Number 5 Region: 918-1064
Classification Level Classification E-value
Superfamily Cupredoxins 1.88e-43
Family Multidomain cupredoxins 0.0000045
Further Details:      
 
Domain Number 6 Region: 574-718
Classification Level Classification E-value
Superfamily Cupredoxins 9.5e-43
Family Multidomain cupredoxins 0.0000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008874   Gene: ENSGGOG00000009064   Transcript: ENSGGOT00000009117
Sequence length 1159
Comment pep:known_by_projection chromosome:gorGor3.1:X:63364109:63460700:1 gene:ENSGGOG00000009064 transcript:ENSGGOT00000009117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASS
FLKSDKNRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFAT
RPYTIHPHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPAC
LTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWH
LNENIATYCSDPASVDKEDETFQESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNE
IDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMMPWEPGTWLVSCQVNSHFRDGMQAL
YKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKS
SSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPF
SMQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYF
SAADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAA
MLDFRLLSEDIEGFQDSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMF
QGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCPG
HQATPRQRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDGLLGSR
YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG
VLESTTGWPLAAEPGEVLTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPL
AICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDETFLE
SNKMHAAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENYRA
DVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSQTEHLSPLTIITKET
EKAVPPRDIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLLLVVLALGGVVWYQHRQRKL
RRNRRSILDDSFKLLSFKQ
Download sequence
Identical sequences ENSGGOP00000008874 ENSGGOP00000008874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]