SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008988 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008988
Domain Number 1 Region: 237-377
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-35
Family cAMP-binding domain 0.000002
Further Details:      
 
Domain Number 2 Region: 103-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.02e-32
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 3 Region: 2-26
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008988   Gene: ENSGGOG00000009195   Transcript: ENSGGOT00000009238
Sequence length 387
Comment pep:known_by_projection chromosome:gorGor3.1:3:49994822:50097167:-1 gene:ENSGGOG00000009195 transcript:ENSGGOT00000009238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGD
SESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDI
LLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSV
GQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIE
SVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSN
KDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVTCLVMDVQAFERLLGPCMDI
MKRNISHYEEQLVKMFGSSVDLGNLGQ
Download sequence
Identical sequences ENSGGOP00000008988 ENSGGOP00000008988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]