SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009077 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009077
Domain Number 1 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000597
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 196-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000676
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 351-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000419
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009077   Gene: ENSGGOG00000009292   Transcript: ENSGGOT00000009330
Sequence length 550
Comment pep:known_by_projection chromosome:gorGor3.1:19:33924366:33941310:1 gene:ENSGGOG00000009292 transcript:ENSGGOT00000009330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHMAKPDMIRKLE
QGEELWTQRIFPSYSYLEEDGKTEDVLVKFKEYQDRHSRPLIFINHKKLIKERSNIYGKT
FTLGKNRISKTILCEYKPDGKVLKNISELVIRNISPIKEKFGDSTGWEKSLLNTKHEKIH
PAVNLHKQTERVLSGKQELIQHQKVQAPEQPFDHNECEKSFLMKGMLFTHTRAHRGERTF
EYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKSVFIMPQRPQTEEKPFHCPY
CGNNFRRKSYLIEHQRIHTGEKPYVCNQCGKAFRQKTALTLHEKTHIEGKPFICIDCGKS
FRQKATLTRHHKTHTGEKAYECPQCGSAFRKKSYLIDHQRTHTGEKPYQCNECGKAFIQK
TTLTVHQRTHTGEKPYICNECGKSFCQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILT
VHHRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECKQCGKFFSCKSNLIVHQK
THKVETTGIQ
Download sequence
Identical sequences ENSGGOP00000009077 ENSGGOP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]