SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009174 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009174
Domain Number 1 Region: 200-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.12e-85
Family Myotubularin-like phosphatases 0.0000456
Further Details:      
 
Domain Number 2 Region: 43-186
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000119
Family GRAM domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009174   Gene: ENSGGOG00000009387   Transcript: ENSGGOT00000009428
Sequence length 747
Comment pep:known_by_projection chromosome:gorGor3.1:17:61469221:61555587:1 gene:ENSGGOG00000009387 transcript:ENSGGOT00000009428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLK
YVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGV
FDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHHTQAPKLLKR
LFLFSYATAAQNNTVTDPKNHTVMFDTLKDWCWELERTKGNMKYKAVSVNEGYKVCERLP
AYFVVPTPLPEENVQRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGILQIQKSFLDGI
YKTIHRPPYEVVKTEDLSSNFLSLQEIQTAYSKFKQLFLIDNSTEFWDTDIKWFSLLESS
SWLDIIRRCLKKAIEITECMEAQNMNVLLLEENASDLCCLISSLVQLMMDPHCRTRIGFQ
SLIQKEWVMGGHCFLDRCNHLRQNDKEEVPVFLLFLDCVWQLVHQHPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDTNMGREGQDTQSKPLNLLTVWDWSVQFEPKAQTLLKNPL
YVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSDELQDNFREFYDSWHSKSTDYHGLLLPHIEGPEIKVWAQRYLRWIPEAQILGGGQVAT
MSKLLEMMEEVQSLQEKIDERHHSQQAPQAEGPCLLRNSARLSSLFPFALLQRHSSKPVL
PTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences A0A2I2YTX3
ENSGGOP00000009174 XP_004059039.1.27298 ENSGGOP00000009174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]