SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009261
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily t-snare proteins 8.63e-31
Family t-snare proteins 0.00000999
Further Details:      
 
Domain Number 2 Region: 153-221
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.79e-16
Family SNARE fusion complex 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009261   Gene: ENSGGOG00000009480   Transcript: ENSGGOT00000009520
Sequence length 251
Comment pep:known_by_projection chromosome:gorGor3.1:19:13394337:13402327:-1 gene:ENSGGOG00000009480 transcript:ENSGGOT00000009520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWD
LEDLEETIDPRIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERN
NREILTGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLK
HMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGV
LLLVLILLFSL
Download sequence
Identical sequences ENSGGOP00000009261 ENSGGOP00000009261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]