SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009302 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009302
Domain Number 1 Region: 30-302
Classification Level Classification E-value
Superfamily L domain-like 1.83e-60
Family Ngr ectodomain-like 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009302   Gene: ENSGGOG00000009525   Transcript: ENSGGOT00000009562
Sequence length 420
Comment pep:known_by_projection chromosome:gorGor3.1:11:54177716:54193875:1 gene:ENSGGOG00000009525 transcript:ENSGGOT00000009562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPP
STQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLR
SLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLAN
LSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLA
SLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLR
ALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQ
GGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL
Download sequence
Identical sequences A0A2I2ZDA6 A0A2I3RBH3
ENSGGOP00000009302 XP_004051210.1.27298 XP_016776390.1.37143 ENSGGOP00000009302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]