SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009338 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009338
Domain Number 1 Region: 50-273
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.42e-49
Family Mammalian PLC 0.00011
Further Details:      
 
Domain Number 2 Region: 291-407
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.7e-28
Family PLC-like (P variant) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009338   Gene: ENSGGOG00000009552   Transcript: ENSGGOT00000009598
Sequence length 1251
Comment pep:known_by_projection chromosome:gorGor3.1:3:156173177:156237569:-1 gene:ENSGGOG00000009552 transcript:ENSGGOT00000009598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYNNGTTEHQVESFIRKKLESLLKES
QIRDKEDPDSFTVRALLKATHEGLNAHLKQSPDVKESGKKSHGRSLMTNFGKHKKTTKSR
SKSYSTDDEEDTQQNTGKEGGQLYRLGRRRKTMKLCRELSDLVVYTNSVAAQDIVDDGTT
GNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSSNFNPLPYWNAGCQLVAL
NYQSEGRMMQLNRAKFKANGNCGYVLKPQQMCKGTFNPFSGDPLPANPKKQLILKVISGQ
QLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTRVVDDNGFNPVWEETLTFTVHMP
EIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVYLEGLTEASIFVHITINEIYGKW
SPLILNPSYTILHFLGATKNRQLQGLKGLFNKNPRHSSSENNSHYVRKRSIGDRILRRTA
SAPAKGRKKSKMGFQEMVEIKDSVSEATRDQDGVLRRTTRSLQARPVSMPVDRNLLGALS
LPVSETAKDIEGKENSLAEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLHKDTSQGDA
IVSTSHMSVTGEQLGMSSPRGGRTTSNATSNCQENPCPSKSLSPKQHLAPDPVVNPTQDL
HGVKIKEKGNAEDFVEGKSILSGSILSHSNLEIKNLEGNRGKGRAATSFSLSDVSMLCSD
IPDLHSTAILQESEISHLIDNVTLTNENEPGSSISALIGQFDETNNQALTVVSHLHNTSV
ISGHCPLPSLGLKMPIKHGFCKGKSKSSFLCSSPELIALSSSETTKHATNTVYETTCTPI
SKTKPDDDLSSKAKTGALESNLPGSPNTSHGWLPKSPTKGEDWETLKSCSPASSPDLTLE
DVIADPTLCFNSGESSLVEIDGESENLSLTTCEYRREGTSQLASPLKLKYSQGVVERFQR
GLRNGYCKETLCPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQ
SSAQDMHVPVPKQLAHLPLPALKLPSPCKSKSLGDLTSEDIACNFESKYQCISKSFVTTG
IRDKKGVTVKTKSLEPIDALTEQLRKLVSFDQEDNCQVLYSKQDANQLPRALVRKLSSRS
QSRVRNIASRAKEKQEANKQKVPNPSNGAGVVLRNKPSAPTPAVNRHSTGSYIAGYLKNT
KGGGLEGRGIPEGACTALHYGHVDQFCSDNSVLQTEPSSDDKPEIYFLLRL
Download sequence
Identical sequences ENSGGOP00000009338 ENSGGOP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]