SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009419 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009419
Domain Number 1 Region: 3115-3426
Classification Level Classification E-value
Superfamily BEACH domain 1.24e-111
Family BEACH domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 3544-3791
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-33
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 3016-3119
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009419   Gene: ENSGGOG00000009620   Transcript: ENSGGOT00000009683
Sequence length 3805
Comment pep:known_by_projection chromosome:gorGor3.1:1:215939655:216101741:-1 gene:ENSGGOG00000009620 transcript:ENSGGOT00000009683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQEAFTCHEYMVKRLLSLLIVVLKISLYPLNPLDFNLPLSADIILTKEKNSSSQRSTQ
EKLHLEGSALSSQVSAKVNVFRKSRRQRKITHRYSVRDARKTQLSTSDSEANSDEKGIAM
NKHRRPHLLQHFVTSFPKQDHPKAKLDRLATKEEQTPPDAMALENSREIIPRQGSNTDIL
SEPAALSVISNMNNSPFDLCHVLLSLLEKVCKFDVTLNHNSPLAASVVPTLTEFLAGFGD
CCSLSDNLESRVVSAGWTEEPVALIQRMLFRTVLHLLSVDVSTAEMMPENLRKNLTELLR
AALKIRICLEKQPDPFAPRQKKTLQEVQEDFVFSKYRHRALLLPELLEGVLQILICCLQS
AASNPFYFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPPEASEHLKALINSVMK
IMSTVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETAD
GDVYYPERCCCIAVCAHQCLRLLQQASLSSTCVQILLGVHNIGICCCMDPKSVIIPLLHA
FKLPALKNFQQHILNILNKLILDQLGGAEISPKIKKAACNICTVDSDQLAQLEETLQGNL
CDAELSSSLSSPSYRFQGILPSSGSEDLLWKWDALKAYQNFVFEEDRLHSIQIANHICSL
IQKGNIVVQWKLYNYIFNPVLQRGVELAHHCQHLSVTSAQSHVCSHHNQCLPQDVLQIYV
KTLPILLKSRVIRDLFLSCNGVSQIIELNYLNGIRSHSLKAFETLIISLGEQQKDASVPG
IDGIDIEQKELSSVHVGTSFHHQQAYSDSPQSLSKFYAGLKEAYPKRRKTVNQDVHINTI
NLFLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLSHMLPCISLESLVLPSPEHMH
QAADIWSMCRWIYMLSSVFQKQFYRLGGFRVCHKLIFMIIQKLFRSHKEEQGKKEGDTNV
NENQDLNRISQPKRTMKEDLLSLAIKSDPIPSELGSLKKSADSLGKLELQHISSINVEEV
SATEAAPEEAKLFTSQESETSLQSIRLLEALLAICLHGARSSQQKMELELPNQNLSVESI
LFEMRDHLSQSKVIETQLAKPLFDALLRVALGNYSADFEHNDAMTEKSHQSAEELSSQPG
DFSEEAEDSQCCSFKLLVEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPSDLL
ENLTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNVFLLMQQGTVKN
LLGGFLSILTQADSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTKILLLG
ILKIIESDTTMSPSQYLTFPLLHAPNLSNGVSSQKYPGILNSKAMGLLRRARVSRSKKET
DRESFPHRLLSSWHIAPVHLPLLGQNCWPHLSEGFSVSLWFNVECIHEAETTTEKGKKIK
KRNKSLILPDSSFDGTESDRPEGAEYINPGERLIEEGCIHIISLGSKALMIQVWADPHNA
TLIFRVCMDSNDDMKAVLLAQVESQENIFLPSKWQHLVLTYLQQPQGKRRIHGKISIWVS
GQRKPDVTLDFMLPRKTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLYSGAKV
GSQEAFYLYACGPNHTSVMPCKYGKPVNDYSKYINKEILRCEQIRELFMTKKDVDIGLLI
ESLSVVYTTYCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSILLEPHHLKNLQPTEY
KTIQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGL
SMIHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNAIIQDVKLLEELL
LDWKIWNKAEQGVWETLLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKE
GQLTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSL
HIDGKIFQEKVRSIMYLRHSSSGGRSLMSPGFMIISPSGFTASPYEGENSSNIIPQQMAA
HMLRSRSLPAFPTSSLLMQSQKLTGSLGCSIDRLQNIADTYVATQSKKQNSLGSSDTLKK
GKEDAFISSCESAKTVCEMEAVLSAQVSVSDVPKGVLGFPVVKADHKELGAEPRSEDDSP
GDESCPRRPDYLKGLASFQRSHSTIASLGLAFPSQNGSAAVGRWPSLVDRNTDDWENFAY
SLGYEPNYNRTASAHSVTEDCLVPICCGLYELLSGVLLILPDVLLEDVMDKLIQADTLLV
LVNHPSPAIQQGVIKLLDAYFARASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIE
MFFGRHIGLDEEFDLEDVRNMGLFQKWSVIPILGLIETSLYDNILLHNALLLLLQILNSC
SKVADMLLDNGLLYVLCNTVAALNGLEKNIPVSEYKLLACDIQQLFIAVTIHACSSSGSQ
YFRVIEDLIVMLGYLQNSKNKRTQNMAVALQLRVLQAAMEFIRTTANHDSENLTDSLQSP
SAPHHAIVQKRKSIAGPRKFPLAQTESLLMKMRSVANDELHVMMQRRMSQENPSQATETE
LAQRLQRLTVLAVNRIIYQVKEFNSDIIDILRTPENVTQSKTSVFQTEISEENIHHEQSS
VFNPFQKEIFTYLVEGFKVSIGSSKASGSKQQWTKILWSCKETFRMQLGRLLVHILSPAH
AAHERKQIFEIVHEPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQDELTEEELDTAEL
LMNALKLCGHKCVPPSASTKADLIKMIKEEQKKYETEEGVNKAAWQKTVNNNQQSLFQRL
DSKSKDISKIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAV
WYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDVVKPPLSYLFEDK
THSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSL
QGELEPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILT
NNLPNLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSE
TLDLNDPLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSH
YSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPE
FFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQ
WIDLVFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFH
MAHVSRPGAKLNIEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSP
SAPVPVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAI
LSWGYADNILRLKSKQSEPPVNFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRF
TSSTPSEIEMETQIHLYGHTEEITSLFVCKPYSILISVSRDGTCIIWDLNRLCYVQSLAG
HKSPVTAVSASETSGDISTVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEG
VSINVIAGGLENGIVRLWSTWDLKPVREITFPKSNKPIISLTFSCDGHHLYTANSDGTVI
AWCRKDQQRLKQPMFYSFLSSYAAG
Download sequence
Identical sequences ENSGGOP00000009419 ENSGGOP00000009419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]