SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009460 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009460
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.83e-24
Family Cofilin-like 0.005
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009460
Domain Number - Region: 381-390,548-557
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.012
Family Formin homology 2 domain (FH2 domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009460   Gene: ENSGGOG00000009680   Transcript: ENSGGOT00000009725
Sequence length 666
Comment pep:known_by_projection chromosome:gorGor3.1:5:162055426:162071997:-1 gene:ENSGGOG00000009680 transcript:ENSGGOT00000009725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGED
VPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLR
LREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQE
RMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHM
KKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKAS
DSGPSSSSSSSSSPPRTPFPYITCHRTPNLSSSLPCSHLDSHRRMAPTPIPTRSPSDSST
ASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEE
PPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATANATEVHGAADAIETDTATADTT
VANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPA
GEGCATLLNFDELPEPPATFCDPEEVEGEPLAAPQIPTLPSALEELEQEQEPEPHLLTNG
ETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEE
GFEGGD
Download sequence
Identical sequences G3R2K6
ENSGGOP00000009460 ENSGGOP00000009460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]