SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009469 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009469
Domain Number 1 Region: 373-451
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.36e-23
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 138-173
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000204
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Prefoldin 0.0000863
Family Prefoldin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009469   Gene: ENSGGOG00000009695   Transcript: ENSGGOT00000009734
Sequence length 525
Comment pep:known_by_projection chromosome:gorGor3.1:5:43429482:43435191:1 gene:ENSGGOG00000009695 transcript:ENSGGOT00000009734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSSRVSSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGASGGFY
SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
PGSGDGGLGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLKKNHEEEMKNMQGSSGGEVTV
EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEEQFNKQSASLQAQISTDAGAATSAKNE
ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIRGE
TKCQNAEYEQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSINMGSRDLASGD
SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
Download sequence
Identical sequences G3R2L4
ENSGGOP00000009469 XP_004041826.1.27298 ENSGGOP00000009469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]