SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009483 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009483
Domain Number 1 Region: 188-381
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-43
Family Pentraxin (pentaxin) 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009483
Domain Number - Region: 88-145
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0641
Family Apolipoprotein A-I 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009483   Gene: ENSGGOG00000009709   Transcript: ENSGGOT00000009748
Sequence length 391
Comment pep:known_by_projection chromosome:gorGor3.1:5:2671571:2681292:1 gene:ENSGGOG00000009709 transcript:ENSGGOT00000009748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARAARGATTCALLALCLLGAGAQDFGPTRFXRETVLQQKETILSQKETIRELTAKLGRCE
SQSTLDPKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNS
LKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKD
NRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANE
LVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENL
APYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKA
LSGNVIAWAESHIEIYGGATKWTFEACRQIN
Download sequence
Identical sequences ENSGGOP00000009483 ENSGGOP00000009483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]