SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009529 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009529
Domain Number 1 Region: 221-478
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-83
Family Nuclear receptor ligand-binding domain 0.000000000849
Further Details:      
 
Domain Number 2 Region: 152-233
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009529   Gene: ENSGGOG00000009752   Transcript: ENSGGOT00000009795
Sequence length 482
Comment pep:known_by_projection chromosome:gorGor3.1:9:118022838:118064366:1 gene:ENSGGOG00000009752 transcript:ENSGGOT00000009795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASVAGGSRHLVGPGVTCTDHSPAASCLADFSTQVNSSLTSSTGRGSMAAPSLHPSLGPG
IGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP
VSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFK
RTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEV
ESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV
EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSA
GVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVETLREKVYASL
EAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQ
MT
Download sequence
Identical sequences ENSGGOP00000009529 ENSGGOP00000009529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]