SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009661 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009661
Domain Number 1 Region: 51-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000131
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 321-367
Classification Level Classification E-value
Superfamily RING/U-box 0.000000127
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 264-300
Classification Level Classification E-value
Superfamily SAP domain 0.0000168
Family SAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009661   Gene: ENSGGOG00000009889   Transcript: ENSGGOT00000009928
Sequence length 373
Comment pep:known_by_projection chromosome:gorGor3.1:12:121278658:121299385:1 gene:ENSGGOG00000009889 transcript:ENSGGOT00000009928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPN
IVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLK
VKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSF
FSNYTAPSATMSSFQGELMDGEQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENA
EDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRL
YKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPIC
RQYVVRAVHVFKS
Download sequence
Identical sequences G3SFL8
ENSGGOP00000009661 XP_018893924.1.27298 XP_018893925.1.27298 ENSGGOP00000028278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]