SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009723 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009723
Domain Number 1 Region: 216-282
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 285-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009723
Domain Number - Region: 58-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0851
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009723   Gene: ENSGGOG00000009957   Transcript: ENSGGOT00000010001
Sequence length 621
Comment pep:known_by_projection chromosome:gorGor3.1:3:182156137:182220698:1 gene:ENSGGOG00000009957 transcript:ENSGGOT00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADY
ISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGE
EKINTLKEENTQEAAVLNGVS
Download sequence
Identical sequences A0A2K5NFP0 A0A2K6A2D7 A0A2K6PXZ1 F7H8W8 H2PC42 K6ZIX4 P51114
ENSP00000417125 ENSPPYP00000016024 ENSPTRP00000026942 NP_005078.2.87134 NP_005078.2.92137 XP_001098757.3.72884 XP_003832026.2.60992 XP_005546534.1.63531 XP_010350829.1.97406 XP_011944165.1.92194 gi|61835148|ref|NP_005078.2| 9598.ENSPTRP00000026942 9600.ENSPPYP00000016024 9606.ENSP00000350170 ENSPTRP00000026942 ENSGGOP00000009723 ENSPPYP00000016024 ENSP00000350170 ENSP00000350170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]