SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009795 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009795
Domain Number 1 Region: 274-497
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.05e-85
Family Fibrinogen C-terminal domain-like 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009795   Gene: ENSGGOG00000010038   Transcript: ENSGGOT00000010075
Sequence length 497
Comment pep:known_by_projection chromosome:gorGor3.1:8:6365927:6427958:-1 gene:ENSGGOG00000010038 transcript:ENSGGOT00000010075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNRSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATV
NNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYT
LTFSNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEF
VSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQP
GNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKG
SGYSLKATTMMIRPADF
Download sequence
Identical sequences ENSGGOP00000009795 ENSGGOP00000009795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]