SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009838 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009838
Domain Number 1 Region: 451-641
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-44
Family cAMP-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 216-444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-27
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009838   Gene: ENSGGOG00000010075   Transcript: ENSGGOT00000010121
Sequence length 803
Comment pep:known_by_projection chromosome:gorGor3.1:8:85273486:85444168:-1 gene:ENSGGOG00000010075 transcript:ENSGGOT00000010121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTKVNKVKPIGENNENEQSSHRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPV
TSEEPHTSIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKESPNSPQNKLPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEEHYYRLLCFKVKKMPLTEYLKRLKLPNSIDSYTDRLYLLWLLLVTLAYNWNCWFIPLR
LVFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSDELRKHYRTSTK
FQLDVASIIPFDICYLFFGFNPIFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGY
LLFILHINACVYYWASNYEGIGTTRWVYDGEGNEYLRCYYWAVRTLITIGGLPEPQTLFE
IVFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRV
RTWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLR
LKSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAG
GGNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPR
KDLAFLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDK
QKENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTSRQSLII
SMAPSAEGGEEVLTIEVKEKAKQ
Download sequence
Identical sequences ENSGGOP00000009838 ENSGGOP00000009838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]