SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009922 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009922
Domain Number 1 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-27
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 336-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 608-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 66-120
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000353
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009922
Domain Number - Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0032
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009922   Gene: ENSGGOG00000010173   Transcript: ENSGGOT00000010209
Sequence length 671
Comment pep:known_by_projection chromosome:gorGor3.1:19:41687559:41709627:-1 gene:ENSGGOG00000010173 transcript:ENSGGOT00000010209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACAGSTREAGSGAQDLSTLPCLEESMEEQDEKPPEPLKACAQDSFLPQEIIIKVEGED
TGSLTIPCQEGVNFKIVTVDFTQEEQGTWNPAQRTLDRDVILENHRDLVSWDLATAVEKK
DSASKQRIFDEEPANGVKIERFTRDDPWLSSCEEVGDYKDQLEKQQEKQEILLQEVAFTQ
RKAVIHERVYKSDEPREKSGLNSSLFSSPIIPIRNHFHKHVSHAKKWHLNSAVNSHQKIN
ENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDRIQSFCHGTPLHIHEKIHGGGKT
FDFKERGQVLNAKISHNEQQRIPFEESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGK
SFSWSSHLVAHQRTHTGEKPYECSECGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQ
SYVLVVHQRTHTGEKPYECNQCGKSFRQSYKLIAHDYKLIAHQRIHTGEKPYECNQCGKS
FSQSYKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQRTHTGEKPYECSECGKSFNRS
SHLVMHQRIHTGEKPYECNQCGKSFSQSYVLVVHQRTHTGEKPYECSQCGKSFRQSSCLT
QHQRTHTGEKPFECNQCGKTFSLSARLIVHQRTHTGEKPFTCIQCGKAFINSYKLIRHQA
THTEEKLYECN
Download sequence
Identical sequences ENSGGOP00000009922 ENSGGOP00000009922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]