SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009950 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009950
Domain Number 1 Region: 2070-2114
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000079
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 2 Region: 831-1052
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000012
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Domain Number 3 Region: 475-600,642-712
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000316
Family Extended AAA-ATPase domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009950   Gene: ENSGGOG00000010175   Transcript: ENSGGOT00000010238
Sequence length 3280
Comment pep:known_by_projection chromosome:gorGor3.1:5:2752905:2808991:-1 gene:ENSGGOG00000010175 transcript:ENSGGOT00000010238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCDGDWEHCYLPSAFSQHKVFVTPQAPLKAIQAYLAGHYRVPKQTLSAAAVFNDRLCVG
IVASERAGVGKSLYVKRLHDKMKTQLNVKNVPLKTIRLIDPQVDESRVLGALLPFLDAQY
QKVPVLFHLDVTSSVQTGIWVFLFKLLILQYLMDINGKMWLRNPCHLYIVEILERRTSVP
SRSSSALRTRVPQFSFLDIFPKVTCRPPKEVIDMELSALRSDTEPGMDLWEFCSETFQRP
YQYLRRFNQNQDLDTFQYQEGSVEGTPEECLQHFLFHCGVINPSWSELRNFARFLNYQLR
DCEASLFCNPSFIGDTLRGFKKFVVTFMIFMARDFATPSLHTSDQSPGKHMVTMDGVREE
DLAPFSLRKRWESEPHPYVFFNDDHTTMTFIGFHLQPNINGSVDAINHLTRKVIKRDVMT
RDLYQGLLLQRVPFNVDFDKLPRHKKLERLCLTLGIPQATDPDKTYELTTDNMLKILAIE
MRFRCGIPVIIMGETGCGKTRLIKFLSDLRRGGTNADTIKLVKVHGGTTADMIYSRVREA
ENVAFANKDQHQLDTILFFDEANTTEAISCIKEVLCDHTVDGQPLAEDSGLHIIAACNPY
RKHSEEMICRLESAGLGYRVSMEETADRLGSIPLRQLVYRVHALPPSLIPLVWDFGQLSD
VAEKLYIQQIVQRLVDSISLDENGTRVITEVLCASQGFMRKTEDECSFVSLRDVERCVKV
FRWFHEHSAMLLAQLNAFLSKSSVSKNHTERDPVLWSLMLAIGVCYHASLEKKDSYRKAI
ARFFPKPYDDSRLLLDEITRAQDLFLDGVPLRKTIAKNLALKENVFMMVICIELKIPLFL
VGKPGSSKSLAKTIVADAMQGPAAYSDLFRSLKQVHLVSFQCSPHSTPQGIISTFRQCAR
FQQGKDLQQYVSVVVLDEVGLAEDSPKMPLKTLHPLLEDGCIEDDPAPHKKVGFVGISNW
ALDPAKMNRGIFVSRGSPNETELIESAKGICSSDILVQDRVQGYFASFAKAYETVCKSQD
KEFFGLRDYYSLIKMVFAAAKASNRKPSRQDIAQAVLRNFSGKDDIQALDIFLANLPEAK
CSEEVSPMQLIKQNIFGPSQKVPGGEQEDAESRYLLVLTKNYVALQILQQTFFEGDQQPE
IIFGSGFPKDQEYTQLCRNINRVKICMETGKMVLLLNLQNLYESLYDALNQYYVHLGGQK
YVDLGLGTHRVKCRVHPNFRLIVIEEKDVVYKHFPIPLINRLEKHYLDINTVLEKWQKSI
VEELRAWVEKFINVKADHFQKRHKYSPSDVFIGYHSDACASVVLQVIERQGPRALTEELH
QKVSGEAKLILLNCATPDAVVRLSAYSLGGFAAESLSQEYFYRQRHNSFADFLQAHLHAA
DLERHAIFTEITTFSRLLTSHDCEILESEVTGRAPKPTLLWLQQFDTEYSFLKEVRNCLT
NTAKCKILIFQTDFEDGIHSAQLIASAKYSVINEINKIRENEDRIFVYFITKLSRMGRGA
AYVGFHGGLWQSVHIDDLRRSTLMVSDVTRLQHVAISQLFAPGDLPELGLEHRVEDGHEE
AMETEASTSGEVAEVAEEAMETESSEKVGKETSELGGSDVSILDTTRLLRSCVQSAVGML
RDQNESCTRNMRRVVLLLGLLNEDNACHASFLRVSKMRLSVFLKKQEESQLHPLEWLARV
ACNQDALQEAGTFRHTLWKRVQGAVTPLLASMISFIDRDGNLELLTRPDTPPWARDLWMF
IFSDTMLLNIPLVMNNERHKGEMAYIVVQNYMNLSESASNSVPFSWRIKDYLEELWLQAQ
YITDAEGLPKKFVDIFQQTPLGRFLAQLHGEPQQELLQCYLKDFILLTMRVSTEEELKFL
QMALWSCTRKLKAASEAPEEEVSLPWVHLAYQRFRSRLQNFSRILTIYPQVLHSLMEARW
NHDLAGCEMTLDAFAAMACTEILTRNTLKPSPQAWLQLVKNLSMPLELICSDEHMQGSGS
LAQAVIREVRAQWSRISSTALFVEHVLLGTESRVPELQGLVTEHVFLLDKCLRENSDVKT
HGPFEAVMRTLCECKETASKTLSRFGVQPCPICLGDAKDPVCLPCDHVHCLRCLRAWFAS
EQMICPYCLTALPDEYSPAVSQEHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKE
VIESLLSLLFVQKERLRDAPQSHCEHTKSLSPFNDVVDKTPVIRSVILKLLLKYSFHDVK
DYIQEYLTLLKKKAFITEDKTELYMLFINCLEDSILEKTSAYSRNDELNHLEEEGRFLKV
YSPASRGREPANEASVEYLQEVARIRLCLDRAADFLSEREGGPEMAKEKQCYLQQVKQFC
IRVENDWHRVYLVRKLSSQRGMEFVQGLSKPGRPHQWVFPKDVVKQQGLQQDHPGQMDRY
LVYGDEYKALRDAVAKAVLECKPLGIKTALKACKTPRSQQSAYFLLTLFREVAILYRSHN
ASLHPTPEQCEAVSKFIGECKILSPPDISRFATSLVDNSLPLLRAGPSDSNLDGTVTEMA
IHAAAVLLCGQNELLEPLKNLAFSPATMAHAFLPTMPEDLLAQARRWKGLERVHWYTCPN
GHPCSVGECGRPMEQSTCIDCHAPIGGIDHKPRDGFHLVKDKADRTQTGHVLGDPQRRDV
VTCDRGLPPVVFLLIRLLTHLALLLGASQSSQALINIIKPPARDPKGFLQQHILKDLEQL
AKMLGHSADETIGVVHLVLRRLLQEQHQLSSRRLLNFDTELSTKEMRNNWEKEIAAVISP
ELEHLDKTLPTMNNLISQDKRIRSNPVAKIIYGDPVTFLPHLPRKSVVHCSKIWSCRKRI
TVEYLQHIVEQKNGQERVPILWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVQQVEYS
SIRGFLSKHSSDGLRQLLHNRITVFLSTWNKLRRSLETNGEINLPKNYCSTDLDLDTEFE
ILLPRRQGLGLCATALVSYLIRLHNEIVYAVEKLSEENNSYSVDAAEVTDLHVISYEVER
DLTPLILSNCQYQVEEGRETVQEFDLEKIQRQIVSRFLQGKPRLSLKGIPTLVYRHDWNY
EHLFMDIKNKMAQDSLPSSVISAISGQLQSYSDACEVLSVVEVTLGFLSTAGGDPNMQLN
VYTQDILQMGDQTIHVLKALNRCQLKHTIALWQFLSAHKSEQLLRLHKEPFGEISSRYKA
DLSPENAKLLSTFLNQIGLDAFLLELHEMIILKLKNPQTQTEGRFRPQWSLRDTLVSYMQ
TKESEILPEMASQFPEEILLANCVSVWKTAAVLKWNREMR
Download sequence
Identical sequences ENSGGOP00000009950 ENSGGOP00000009950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]