SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009958 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009958
Domain Number 1 Region: 57-196
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.08e-43
Family Gelsolin-like 0.000000283
Further Details:      
 
Domain Number 2 Region: 424-568
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.01e-38
Family Gelsolin-like 0.000000213
Further Details:      
 
Domain Number 3 Region: 657-773
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.78e-34
Family Gelsolin-like 0.000000561
Further Details:      
 
Domain Number 4 Region: 294-405
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.4e-29
Family Gelsolin-like 0.000000996
Further Details:      
 
Domain Number 5 Region: 177-281
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.73e-28
Family Gelsolin-like 0.00000259
Further Details:      
 
Domain Number 6 Region: 554-656
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.74e-20
Family Gelsolin-like 0.00000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009958   Gene: ENSGGOG00000010202   Transcript: ENSGGOT00000010246
Sequence length 782
Comment pep:known_by_projection chromosome:gorGor3.1:9:104084997:104118002:1 gene:ENSGGOG00000010202 transcript:ENSGGOT00000010246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRGXSSQPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRFERLKA
TQVSKGIRDNERSGRARVHVSEEGAEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTDPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKMGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPASRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA
Download sequence
Identical sequences ENSGGOP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]