SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010209 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010209
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 512-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000148
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000124
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 
Domain Number 8 Region: 374-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000121
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010209   Gene: ENSGGOG00000010468   Transcript: ENSGGOT00000010508
Sequence length 683
Comment pep:known_by_projection chromosome:gorGor3.1:16:3472316:3480267:1 gene:ENSGGOG00000010468 transcript:ENSGGOT00000010508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPGCQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNVEDKEMTGPQLPESLEDVAMYISQEEWGRQDPSKRA
LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVPSVSSENIHPQVLLPDQARGEVPWSPELGRPRDRPQGDWAPPPEGGMEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences G3R4K3
XP_004057124.1.27298 ENSGGOP00000010209 ENSGGOP00000010209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]