SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000010268

Domain assignment for ENSGGOP00000010268 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000010268
Domain Number 1	Region: 5-192
Classification Level	Classification	E-value
Superfamily	PR-1-like	2.62e-46
Family	PR-1-like	0.000022
Further Details:

Domain Number 2	Region: 194-248
Classification Level	Classification	E-value
Superfamily	Crisp domain-like	0.0000000000000011
Family	Crisp domain	0.0026
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000010268 Gene: ENSGGOG00000010522 Transcript: ENSGGOT00000010569
Sequence length	249
Comment	pep:known_by_projection chromosome:gorGor3.1:6:51381825:51414116:-1 gene:ENSGGOG00000010522 transcript:ENSGGOT00000010569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPAS NMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWY SESTSFKHGEWTTTDDDITTDHYTQIVWAISYLIGCAIASCRQQGSPRYLYVCHYCHEGN DPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDVQVHYLGCNHSTTVLFCKA TCLCDTEIK
Download sequence
Identical sequences	G3R4Q7 ENSGGOP00000010268 XP_004044219.1.27298 XP_004044221.1.27298 ENSGGOP00000010268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]