SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010283 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010283
Domain Number 1 Region: 1215-1319,1373-1540
Classification Level Classification E-value
Superfamily Cullin homology domain 7.98e-41
Family Cullin homology domain 0.00044
Further Details:      
 
Domain Number 2 Region: 778-970
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-35
Family APC10-like 0.0055
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-32
Family CPH domain 0.00000606
Further Details:      
 
Domain Number 4 Region: 140-201,667-825
Classification Level Classification E-value
Superfamily ARM repeat 0.00000233
Family RPA1889-like 0.068
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010283
Domain Number - Region: 1550-1646
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0141
Family Penicillinase repressor 0.036
Further Details:      
 
Domain Number - Region: 962-1071
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0602
Family Cullin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010283   Gene: ENSGGOG00000010532   Transcript: ENSGGOT00000010586
Sequence length 1698
Comment pep:known_by_projection chromosome:gorGor3.1:6:44294723:44310918:-1 gene:ENSGGOG00000010532 transcript:ENSGGOT00000010586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDC
KAEHILLWMSKDEIYANCHKMLDEDGQVIGPSQESVGEVGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGAQNTSAPEELSGERGQLELEFSMAM
GTLISELVQAMRWDQASDRPRSSARSSSSIFQPQLADVSPGRPAAQAQPSFRRSRRFRPR
SEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGKFRQSNNGVPPVQVFWESTGRT
YWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLGRALPAWRWRPMTELYAVPYVLPED
EDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELA
QDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDVLLLEAQAQAKD
SEDAAKAEAKEPPSQSPNTPLQRLVEGYGPAGKILLDLEQALSSEGTQENKVKPLLLQLK
RQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDFPEALLLPWHEAVDACMACLRSPNT
DREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCE
KHAHLYRKLITNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSVEVKEDKC
WEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYITLHMRQGILIRQLTLLVASEDSSY
MPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTR
IRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDMAEDRRSLLHLSSRLNGALRQ
EQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITSPDEDGISPLGWLLDQYLECQEAVF
NPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATPRPKGRNRSHDWSSLATRGLPSSIM
RNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHFNILQNSSSELFGPRAAFLLALQNG
CAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGAQEMERLAQLQQCLQAVLIFSGLEI
ATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSKELQRQFHV
YQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDL
YYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALER
GSQRRLQWTWLGWAELQFGNQTLHVSTMQMWLLLYLNDLKAVSVESLLALSGLSADMLNQ
AIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEEGRNL
EKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTD
VLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRS
RGVPYASCTATQSFSTFR
Download sequence
Identical sequences ENSGGOP00000010283 XP_004044085.1.27298 ENSGGOP00000010283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]