SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010379
Domain Number 1 Region: 120-344
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.49e-82
Family Fibrinogen C-terminal domain-like 0.00000106
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010379
Domain Number - Region: 46-126
Classification Level Classification E-value
Superfamily t-snare proteins 0.0549
Family t-snare proteins 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010379   Gene: ENSGGOG00000010647   Transcript: ENSGGOT00000010684
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:1:11418728:11433229:1 gene:ENSGGOG00000010647 transcript:ENSGGOT00000010684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKPLSAVTWLCIFIVAFVSHPAWLQKPSKRKTQAQPQLKAANCCEEVKELKAQVANLS
SLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTV
TQTSADAIYDCSSLHQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSG
LVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVL
GNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD
SNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Download sequence
Identical sequences G3R513
ENSGGOP00000010379 XP_018866570.1.27298 ENSGGOP00000010379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]