SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010402 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010402
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000417
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010402   Gene: ENSGGOG00000010665   Transcript: ENSGGOT00000010707
Sequence length 792
Comment pep:known_by_projection chromosome:gorGor3.1:19:55560808:55583726:-1 gene:ENSGGOG00000010665 transcript:ENSGGOT00000010707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALTDQSWGMTAVDPWASWALCPQDPAWHVEGSLEEGRRATGLPAAQVQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WSVEQACPQRTCPEWVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRSSEFCGLGAEFSQNLNFVPSQRVSQIEHFYKP
DTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNH
IIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECGKAFSGHSALL
QHQRNHSEEKLN
Download sequence
Identical sequences G3SCV4
ENSGGOP00000025932 XP_018871284.1.27298 ENSGGOP00000010402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]