SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010620
Domain Number 1 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 234-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-17
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 290-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000768
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000457
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 27-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000589
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010620   Gene: ENSGGOG00000010898   Transcript: ENSGGOT00000010937
Sequence length 484
Comment pep:novel chromosome:gorGor3.1:X:151290069:151294567:1 gene:ENSGGOG00000010898 transcript:ENSGGOT00000010937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVVESFTYFAIWKKKIIYGKTDPWEFFQDLVTFDDVAWYLTTREWFKLDPEQRALEYYG
NVTSVGVPVLNPALVPHLAQGQVLLVSDPSPNTDPAKYSESTSATQYQMKGEDAQPQEMA
STSFPRATGPSPEFRQHGDSDGKRGSPQNLPIEHHFACKECGDTFRLKVLLVQHQRVHSE
EKGWECGDCGKVFRGVAEFNEHRKSHVAAEPRPGPSRALENAAEKREQMEREAKPFECEE
CGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACKACSRD
FLDRQELLKHQRMHTGHLPFDCDDCGKSFRGVNGLAEHQRIHSGAKPYGCPHCGKLFRRS
SELTKHRRIHTGEKPYACGQCGKAFRQSSSLLEHARIHSGERPYACGECGKAFRGPSDLI
KHRRIHSGLKPYECDKCGKAFRRSSGLSRHRRIHSGARRCECSQCGRVFKRRSALQKHQP
THHE
Download sequence
Identical sequences ENSGGOP00000010620 ENSGGOP00000010620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]