SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010767 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010767
Domain Number 1 Region: 206-323
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 568-724
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-22
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010767   Gene: ENSGGOG00000011048   Transcript: ENSGGOT00000011088
Sequence length 860
Comment pep:known_by_projection chromosome:gorGor3.1:9:111269279:111309255:-1 gene:ENSGGOG00000011048 transcript:ENSGGOT00000011088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSSASISRQSHLEPDTFEATQDDMVTV
PRSPPAYARSSDMYSHMGTMPRPSIKKAQNSQAARQAQEAGPKPNLVPGGVPDPPGLEAA
KEVMVKATGPLEDTPAMEPNPSAVEVDPIRKPEVPTGDIEEERPPRDVHSERAAGEPEAG
GDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDF
LIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYH
VGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSV
TMTDGLTADKVTRSDGCPASTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYS
TVTRVHAAPAAPSATALPASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASP
SPSLSSYSDPDSGHYCQLQPPVRGSREWAATETSSQQARSYGERLKELSENGAPEGDWGK
TFTVPIMEVTSSFNPATFQSLLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCL
VARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEE
RAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRLEQTWVTLRQRHTEGAILYEK
KLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTEHGVEVVLAHL
EAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF
DKVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences G3R631
ENSGGOP00000010767 ENSGGOP00000010767 XP_018888893.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]