SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010771 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010771
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 130-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000031
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 214-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000503
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010771   Gene: ENSGGOG00000011056   Transcript: ENSGGOT00000011092
Sequence length 463
Comment pep:known_by_projection chromosome:gorGor3.1:19:51016577:51024243:1 gene:ENSGGOG00000011056 transcript:ENSGGOT00000011092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEK
NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPR
THQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKI
HTGEKPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGE
KDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYE
CQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTEC
GKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSF
SHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS
Download sequence
Identical sequences A0A024R4J5 Q9NQX6
ENSP00000253144 ENSP00000253144 ENSP00000393336 ENSP00000393817 ENSP00000421014 ENSP00000421728 ENSP00000423156 ENSP00000427439 ENSGGOP00000010771 9606.ENSP00000253144 ENSP00000253144 ENSP00000393336 ENSP00000393817 ENSP00000421014 ENSP00000421728 ENSP00000423156 ENSP00000427439 ENSGGOP00000010771 gi|120952829|ref|NP_001073375.1| gi|120952914|ref|NP_001073376.1| gi|121583655|ref|NP_061025.5| NP_001073375.1.87134 NP_001073375.1.92137 NP_001073376.1.87134 NP_001073376.1.92137 NP_001240727.1.87134 NP_001240727.1.92137 NP_001240728.1.87134 NP_001240728.1.92137 NP_001240729.1.87134 NP_001240729.1.92137 NP_001240730.1.87134 NP_001240730.1.92137 NP_001304042.1.87134 NP_001304042.1.92137 NP_001304043.1.87134 NP_001304043.1.92137 NP_001304044.1.87134 NP_001304044.1.92137 NP_001304045.1.87134 NP_001304045.1.92137 NP_001304046.1.87134 NP_001304046.1.92137 NP_001304047.1.87134 NP_001304047.1.92137 NP_001304048.1.87134 NP_001304048.1.92137 NP_001304049.1.87134 NP_001304049.1.92137 NP_001304050.1.87134 NP_001304050.1.92137 NP_061025.5.87134 NP_061025.5.92137 XP_011525378.1.92137 XP_011525380.1.92137 XP_016882425.1.92137 XP_016882426.1.92137 XP_016882427.1.92137 XP_016882428.1.92137 XP_016882429.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]