SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010854 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010854
Domain Number 1 Region: 962-1020
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000772
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 158-214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 732-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 853-907
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 907-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 675-735
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 800-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000824
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010854   Gene: ENSGGOG00000011127   Transcript: ENSGGOT00000011175
Sequence length 1064
Comment pep:known_by_projection chromosome:gorGor3.1:9:117155610:117205162:1 gene:ENSGGOG00000011127 transcript:ENSGGOT00000011175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFEVGEGGGAGEEGKGRGRPGRSLCTHAAPARTAHLARSALRSARPFLWEDNLLTRSQG
PPGNHDQLVPDNLEAWALAGPRGLFPKRTLVIWKRSGAGLVVTVALLPRMDGRWQCSCWA
WFLLVLAVVAGDTVSTGSTDNSPTSNSLEGGTDATAFWWGEWTKWTACSRSCGGGVTSQE
RHCLQQRRKFVPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSFNSHVYNGRTHQ
WKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVCVSGKCEPIGCD
GVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSA
DVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYIVAQGPTNQGLN
VMVWNQNGKSPSITFEYTLLQPPHESRPQPIYYGFSEPASESAESQGLDGAGLMGFVPHN
GSLYGQASSERLGLDNRLFGHPGLDMELGPSQGQETNEVCEQAGGGACEGPPRGKGFRDR
NVTGTPLSGDKDDEEVDTRFASQEFFSANAISDQLLGTGSDLKDFTLNETVNSIFAQGAP
RSSLAESFFVDYEENEGAGPYLLNGSYLELSSDRVANSSSEAPFPNVSTSLPTSAGNRTH
KARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRYDGVEVDDSYCDAL
TRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRVVRCWKMLSPGFDSSVYSDLCE
AAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLCDPNTRPV
GEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQMETKPLAIH
PCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLAKKPPEES
TCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPC
PTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences G3R6A8
XP_004048871.1.27298 ENSGGOP00000010854 ENSGGOP00000010854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]