SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010991 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010991
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 399-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 446-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000493
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010991   Gene: ENSGGOG00000011273   Transcript: ENSGGOT00000011315
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:1:24159328:24165359:-1 gene:ENSGGOG00000011273 transcript:ENSGGOT00000011315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQ
QVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVH
TGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEK
PYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences A0A2I2Z5M2 H2N8M9
ENSGGOP00000010991 ENSPPYP00000002018 ENSPPYP00000002018 XP_004024927.1.27298 9600.ENSPPYP00000002018 ENSGGOP00000010991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]