SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011006 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011006
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.53e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011006   Gene: ENSGGOG00000011287   Transcript: ENSGGOT00000011330
Sequence length 221
Comment pep:known_by_projection chromosome:gorGor3.1:2a:71213649:71241548:1 gene:ENSGGOG00000011287 transcript:ENSGGOT00000011330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAIHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL
Download sequence
Identical sequences ENSGGOP00000011006 ENSGGOP00000011006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]