SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011108 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011108
Domain Number 1 Region: 178-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-57
Family SPRY domain 0.000001
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000505
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011108   Gene: ENSGGOG00000011393   Transcript: ENSGGOT00000011435
Sequence length 378
Comment pep:novel chromosome:gorGor3.1:22:16378901:16394500:-1 gene:ENSGGOG00000011393 transcript:ENSGGOT00000011435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPLGGGNLTN
KRPSCAPSPQDLSAQWKQLEDRGASSRRVDMAALFQEASSCPVCSDYPEKPMSLECGCAV
CLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLASHIKELEPKLKKILQMNPR
MRKFQVDMTLDADTANNFLLISDDLGSVRSGLITQNRQHLAERFDVSVCVLGSPRFTCGR
HYWEVDVGTSTEWDLGVCRESVHRKGKIQLTTELGFWTVSLRDGGRLSASTVPLTFLFVD
RKLQRVGIFLDMGMQNVSFFDAKSGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSIC
PLMNSGTTDAPVRPGEAK
Download sequence
Identical sequences ENSGGOP00000011108 ENSGGOP00000017744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]