SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011260 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011260
Domain Number 1 Region: 99-320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.71e-29
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011260
Domain Number - Region: 384-496
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00551
Family Potassium channel NAD-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011260   Gene: ENSGGOG00000011534   Transcript: ENSGGOT00000011590
Sequence length 1149
Comment pep:known_by_projection chromosome:gorGor3.1:8:36955314:37108043:1 gene:ENSGGOG00000011534 transcript:ENSGGOT00000011590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQTKLRNETWEDLPKMSCTTEIQAAFILSSFVTFFSGLIILLIFRLIWRSVKKWQTIKG
TGIILELFTSGTIARSRVRSLHFQGQFRDRIEMLLSAQTFVGQVLVILVFVLSIGSLIIY
FINSADPVGSCSSYEDKTIPIDLVFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILRAIKTSNSVKFSKLLSIILSTWFTAAG
FIHLVENSGDPWLKGRNSQNISYFESIYLVMATTSTVGFGDVVAKTSLGRTFIMFFTLGS
LILFANYIPEMVELFANKRKYTSSYEALKGKKFIVVCGNITVDSVTAFLRNFLRDKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSSMKWEDLRRVAVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHNKVYLPKIPSWNWDTGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVMPKQTWKKHFLNSMKNKILTQHLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNPPPQVRIRKNTLGFFIAETPKDVRRAL
FYCSVCHDDVFIPELITNCGCKSRSRQHITVPSVKRMKKCLKGISSRISGQDSPPRVSAS
TSSISNFTTRTLQHDIEQDSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACV
FGDAHSTPMGLRNFVMPLRASNYTRKELKDIVFVGSLDYLQREWRFLRNFPQIYILPGCA
LYSGDLHAANIEQCSMCVVLSPPPKPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPAVS
EETPGYTNGHNEKSNCRKVPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNR
CKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITR
PANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTEKHSDTNCPPTIDS
VTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDE
DPFAYSEPL
Download sequence
Identical sequences ENSGGOP00000011260 ENSGGOP00000011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]