SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011390 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011390
Domain Number 1 Region: 20-139
Classification Level Classification E-value
Superfamily EF-hand 5.39e-50
Family EF-hand modules in multidomain proteins 0.0000011
Further Details:      
 
Domain Number 2 Region: 141-237
Classification Level Classification E-value
Superfamily EF-hand 7.48e-41
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 217-305
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-22
Family ZZ domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011390
Domain Number - Region: 426-507
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0183
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011390   Gene: ENSGGOG00000011624   Transcript: ENSGGOT00000011722
Sequence length 634
Comment pep:known_by_projection chromosome:gorGor3.1:X:31610733:31714391:-1 gene:ENSGGOG00000011624 transcript:ENSGGOT00000011722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFALCNGHKAENVDPRKMTEELFGDLTDLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAA
CDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTG
RTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLG
EVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKH
QAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDV
RDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLS
HDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPR
SPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTS
PQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGT
TVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPS
SRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE
Download sequence
Identical sequences ENSGGOP00000011390 ENSGGOP00000011390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]