SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011431 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011431
Domain Number 1 Region: 775-869
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.34e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 641-729
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011431
Domain Number - Region: 831-941
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0122
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011431   Gene: ENSGGOG00000011719   Transcript: ENSGGOT00000011764
Sequence length 944
Comment pep:known_by_projection chromosome:gorGor3.1:5:26826788:26860683:-1 gene:ENSGGOG00000011719 transcript:ENSGGOT00000011764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALGVSGSSSPGGCPGWRRLPAAVNTNPVDFAPGAMTEASRMAIQFRSLFPLALPGMLA
LLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPMEDVCSKVVSTPPSVTEPP
EKELSTVSKLPAEPPALLRTHPPCRRSQSSGILPNTTDMRLRPGTRRDDSTKLELALTGG
EAKSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPGKVQPGYPAVPAEKRSSGERARE
TGGAEGTGDAVLGEKVLEEVLLSREHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQ
EEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLD
GNEEGLDRNEESLDRNEGLDRNEEIERAAFQIISQVISEATEQVLATTVGKVAGRVCQAS
QLQGQKEESCVPVHQKTVLGPDTAEPATAEAAAAPPDAGLPLPGLPAEGSPPPKTYVSCL
KSLLSSPTKDSKPNISAHHISLASCLAPTTPSEESPDRAGILVEDATCVTCMSDSSQSVP
LVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPESTVPFSNGVLKGELSDLGAED
GWTVDAEADHSGGSDRNSMDSMDSCCSLKKTESFQNAQAGSNPKKVDLIIWEIEVPKHLV
GRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQICHIEGSQHHVDKALNLIGKKFKELN
LTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSL
DQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVVASYEETNEVEIRYVDYGGY
KRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQV
TSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
Download sequence
Identical sequences ENSGGOP00000011431 ENSGGOP00000023166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]