SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011579 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011579
Domain Number 1 Region: 268-395
Classification Level Classification E-value
Superfamily Second domain of FERM 1.3e-31
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 399-500
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 46-131
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000666
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 179-230
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000537
Family Ras-binding domain, RBD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011579   Gene: ENSGGOG00000011863   Transcript: ENSGGOT00000011914
Sequence length 1812
Comment pep:known_by_projection chromosome:gorGor3.1:X:104913357:104994459:1 gene:ENSGGOG00000011863 transcript:ENSGGOT00000011914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLDSQRVQDRLLATPGCSSPSGQQELFSSHVMQEESANDMECEQLPAEILRQVTVHRD
PIYGFGFVAGSERPVVVRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERLIELIRSAK
EFIVLTVLHTHQSPKSAFISAAKKAKLRSNPVKVRFSEQVAVGETDSKMMKKEALLLIPN
VLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRYIEHFALVLEYAGPEQNHKFLLLQ
DKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMD
PKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKEKNLRKSLS
QQLKAHQTHPSCGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRH
GISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFA
CLIAGYCRLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVG
TSPRKSSHCTPPPADSELVSFCYLHMREQRKEQESQTDVNENLIFFEETRPRTKSDPTSK
SSGQGYEVVPDDFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKTKLQEQLGPRK
GGKPGSSRDNIVDLMSLPPPGSEEEEEEEDETTSLLPAIAAPPPGFRDNSSDEDDPKRRA
VQSQEQGRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAASEDGPH
PPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDS
LLARKDLPFRIQSCAAQAVLTAPYSLGRPDPNTSLQPIATGQSPGPPGARRKLPQSEGQV
QGERTYSLAVHPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVS
ELRDNLPKEIRLSPKLILDPKSSVTPAIISAALQQVVHSKSLVTAGGALGNPPSRGERRL
EASMGRPEVSMMSSSASNNLKFKISPSAPETSRNSQHQLGAEVSSSPRAPTGSRADSLHL
SQQEDSLPVQNFPPKSYLLRTSRESVGKQATGEVAGKGGPVGGKPTLQKQGTISSQGEKA
QLESTPKRSKLEETSLVPRATYPMALQSPSCQSRSHSPSCQPHGHSPSSQSRGQSPSCQP
RGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTR
QKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQ
GPGMSREQRRSCDCKRICRGGRPQATQTPVLSLRGRERDRVLPSQRQPEAGPGVSLSSPI
NVQRIRSTSLESRECRSDPESGVSCLTTCASGGECLGAPNYRKLMRRYSISELDQGDRAS
LTSDVYPHPPLGMLPREAKEVEASLPIALGPKSRSLESPTLGDPSYVQVAPETKGPRQMA
VFSLPEEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGKDELSYSIPMKILPG
MKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKINALRAHAYGL
PDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRASCRRVAN
VDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAA
EESTARNLNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVAAAAGAAAEHPPGSPTSATVM
STFTHSLKTLIK
Download sequence
Identical sequences ENSGGOP00000011579 ENSGGOP00000011579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]